PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_008517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family HD-ZIP
Protein Properties Length: 302aa    MW: 33646.9 Da    PI: 8.3161
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_008517genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-18137191256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ +++k+q  +Le+ F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  DCAR_008517 137 RKKLRLSKDQSAILEDSFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 191
                  788899***********************************************98 PP

2HD-ZIP_I/II128.23.4e-41137226191
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  +kk+rlsk+q+++LE+sF+e+++L+p++K +la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL kev+eLr +l
  DCAR_008517 137 RKKLRLSKDQSAILEDSFKEHNTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTDENRRLMKEVQELR-AL 226
                  69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.1E-265107IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466891.07E-18125194IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.9E-18128187IPR009057Homeodomain-like
PROSITE profilePS5007117.297133193IPR001356Homeobox domain
SMARTSM003892.0E-16135197IPR001356Homeobox domain
PfamPF000465.5E-16137191IPR001356Homeobox domain
CDDcd000861.73E-15137194No hitNo description
PRINTSPR000313.0E-5164173IPR000047Helix-turn-helix motif
PROSITE patternPS000270168191IPR017970Homeobox, conserved site
PRINTSPR000313.0E-5173189IPR000047Helix-turn-helix motif
PfamPF021834.1E-11193227IPR003106Leucine zipper, homeobox-associated
SMARTSM003402.3E-26193236IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008283Biological Processcell proliferation
GO:0009641Biological Processshade avoidance
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009826Biological Processunidimensional cell growth
GO:0010016Biological Processshoot system morphogenesis
GO:0010017Biological Processred or far-red light signaling pathway
GO:0010218Biological Processresponse to far red light
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MMIHQREDHL GLSLSLSSPA ETHRPSSSSS PLQLNLAPSM TSPPFNLFHK KETSDGFVLD  60
ACRVETRSFL KGIDVNRLPA TTVDMEEEAG VSSPNSTISS VSGKRSLERS ENGHGDDLLD  120
CSRGLINSDE EDGDNSRKKL RLSKDQSAIL EDSFKEHNTL NPKQKLALAK RLGLRPRQVE  180
VWFQNRRART KLKQTEVDCE FLKRCCENLT DENRRLMKEV QELRALKLSP QFYMQMTPPT  240
TLTMCPSCER VSAPPSSSTG PSSTPVEAPR PHHSGSSHHR VPFNPWAIAP AGHRSFDAVR  300
H*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135141SRKKLRL
2185193RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX944490.0X94449.1 P.brachycarpa mRNA for homeobox-leucine zipper protein (PHZ4).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589459.11e-127PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054664e-98HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLQ407821e-180Q40782_PIMBR; Homeobox-leucine zipper protein
STRINGVIT_00s0299g00100.t011e-123(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.19e-91homeobox protein 2